Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Invalid characters in fasta sequence #209

Open
srilekha1993 opened this issue Mar 26, 2024 · 0 comments
Open

Invalid characters in fasta sequence #209

srilekha1993 opened this issue Mar 26, 2024 · 0 comments

Comments

@srilekha1993
Copy link

Hi,
After running esm_embedding_preparation.py getting the following output in fasta file
<80>^C}q^@(X^N^@^@^@4d3i_1_chain_0q^AXk^A^@^@MEEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPY

Which contains some invalid characters which are not processed by scripts/extract.py for generating the embedding using esm . Can anyone please tell me how to resolve this issue?

Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment
Labels
None yet
Projects
None yet
Development

No branches or pull requests

1 participant